TMPRSS3 Antibody - N-terminal region (ARP57684_P050)

• Product Number: ARP57684_P050
• Name: TMPRSS3 Antibody - N-terminal region (ARP57684_P050)
• Protein Size (# AA): 344 amino acids
• Molecular Weight: 37kDa
• NCBI Gene Id: 64699
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Transmembrane protease, serine 3
• Alias Symbols: DFNB8, DFNB10, ECHOS1, TADG12
• Peptide Sequence: Synthetic peptide located within the following region: MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a serine protease domain, a transmembrane domain, a LDL receptor-like domain, and a scavenger receptor cysteine-rich domain. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified by its association with both congenital and childhood onset autosomal recessive deafness. This gene is expressed in fetal cochlea and many other tissues, and is thought to be involved in the development and maintenance of the inner ear or the contents of the perilymph and endolymph. This gene was also identified as a tumor associated gene that is overexpressed in ovarian tumors. Alternatively spliced transcript variants have been described.
• Protein Interactions: TMED7; UBC; RXRA; EEF1A1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TMPRSS3 (ARP57684_P050) antibody is Catalog # AAP57684 (Previous Catalog # AAPP42114)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMPRSS3
• Uniprot ID: P57727
• Protein Name: Potential serine protease TMPRSS3 EMBL AAL56664.1
• Publications:

  Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). 23103828

• Protein Accession #: NP_115781
• Purification: Affinity Purified
• Nucleotide Accession #: NM_032405
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: TMPRSS3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-TMPRSS3 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysate
• Image 2: Mouse Brain
  
  WB Suggested Anti-TMPRSS3 Antibody Titration: 5% Milk
  Positive Control: Mouse Brain lysate