| Product Number |
ARP57578_P050 |
| Product Page |
www.avivasysbio.com/fbxw4-antibody-c-terminal-region-arp57578-p050.html |
| Name |
Fbxw4 Antibody - C-terminal region (ARP57578_P050) |
| Protein Size (# AA) |
408 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
309444 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
F-box and WD repeat domain containing 4 |
| Alias Symbols |
Fbxw4 |
| Peptide Sequence |
Synthetic peptide located within the following region: STFYCLQTDGNHLLATGSSYYGLVRLWDRRQRACLHAFPLTSTPLSSPVY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of Fbxw4 remains unknow. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for ARP57578_P050 |
| Blocking Peptide |
Catalog # AAP57578 (Previous Catalog # AAPP34007) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
| Uniprot ID |
D4A2V7 |
| Protein Name |
F-box and WD-40 domain protein 4 (Predicted) EMBL EDL94311.1 |
| Protein Accession # |
NP_001101070 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001107600 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Fbxw4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Rat Muscle
 | WB Suggested Anti-Fbxw4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Rat Muscle |
|
|
