RGD1307041 Antibody - middle region (ARP57230_P050)

Data Sheet
 
Product Number ARP57230_P050
Product Page www.avivasysbio.com/rgd1307041-antibody-middle-region-arp57230-p050.html
Name RGD1307041 Antibody - middle region (ARP57230_P050)
Protein Size (# AA) 399 amino acids
Molecular Weight 42kDa
NCBI Gene Id 361182
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Similar to hypothetical protein FLJ11305
Alias Symbols RGD1307041
Peptide Sequence Synthetic peptide located within the following region: MLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function remains unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Pcid2 (ARP57230_P050) antibody
Blocking Peptide For anti-Pcid2 (ARP57230_P050) antibody is Catalog # AAP57230 (Previous Catalog # AAPP40935)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Rat
Uniprot ID F1MAF5
Protein Name Protein RGD1307041 Ensembl ENSRNOP00000049378
Protein Accession # NP_001162615
Purification Affinity Purified
Nucleotide Accession # NM_001169144
Tested Species Reactivity Rat
Gene Symbol Pcid2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Image 1
Rat Heart
WB Suggested Anti-RGD1307041 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Heart
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com