RAB3IL1 Antibody - middle region (ARP56739_P050)

Data Sheet
 
Product Number ARP56739_P050
Product Page www.avivasysbio.com/rab3il1-antibody-middle-region-arp56739-p050.html
Name RAB3IL1 Antibody - middle region (ARP56739_P050)
Protein Size (# AA) 382 amino acids
Molecular Weight 43kDa
NCBI Gene Id 5866
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name RAB3A interacting protein (rabin3)-like 1
Alias Symbols GRAB
Peptide Sequence Synthetic peptide located within the following region: ARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Krull,M., (2005) Mol. Biol. Evol. 22 (8), 1702-1711
Description of Target RAB3IL1 is a guanine nucleotide exchange factor (GEF) for Rab3A, a GTPase that regulates synaptic vesicle exocytosis.
Protein Interactions NOTCH2NL; CCDC57; KRT40; RAB3IP; TIGD7; SATB2; MTUS2; RAB3IL1; PSMA3; NUDT18; EXOC8; RAB11A; RAB3A; IP6K1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RAB3IL1 (ARP56739_P050) antibody
Blocking Peptide For anti-RAB3IL1 (ARP56739_P050) antibody is Catalog # AAP56739 (Previous Catalog # AAPP39546)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RAB3IL1
Uniprot ID Q8TBN0
Protein Name Guanine nucleotide exchange factor for Rab-3A
Protein Accession # NP_037533
Purification Affinity Purified
Nucleotide Accession # NM_199229
Tested Species Reactivity Human
Gene Symbol RAB3IL1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 100%; Rat: 100%
Image 1
Human Muscle
WB Suggested Anti-RAB3IL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com