Pde4b Antibody - N-terminal region (ARP56255_P050)

• Product Number: ARP56255_P050
• Name: Pde4b Antibody - N-terminal region (ARP56255_P050)
• Protein Size (# AA): 721 amino acids
• Molecular Weight: 82kDa
• NCBI Gene Id: 18578
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Phosphodiesterase 4B, cAMP specific
• Alias Symbols: Dpde, dunc, Dpde4, dunce, R74983
• Peptide Sequence: Synthetic peptide located within the following region: LVNKSIRQRRRFTVAHTCFDVENGPSPGRSPLDPQAGSSSGLVLHAAFPG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The function remains unknown.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-Pde4b (ARP56255_P050) antibody is Catalog # AAP56255 (Previous Catalog # AAPP38222)
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Uniprot ID: Q9QXI7
• Protein Name: CAMP-specific phosphodiesterase EMBL AAF19202.2
• Protein Accession #: NP_062814
• Purification: Affinity Purified
• Nucleotide Accession #: NM_019840
• Tested Species Reactivity: Mouse, Rat
• Gene Symbol: Pde4b
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 77%; Rat: 100%; Zebrafish: 86%
• Image 1: Mouse Heart
  
  WB Suggested Anti-Pde4b Antibody
  Titration: 1.0 ug/ml
  Positive Control: Mouse Heart
• Image 2: Rat Skeletal Muscle
  
  Host: Rat
  Target Name: PDE4B
  Sample Tissue: Rat Skeletal Muscle
  Antibody Dilution: 1ug/ml
• Image 3: Rat Skeletal Muscle
  
  Host: Rabbit
  Target Name: PDE4B
  Sample Tissue: Rat Skeletal Muscle
  Antibody Dilution: 1ug/ml