TMCO4 Antibody - C-terminal region (ARP55797_P050)

Data Sheet
 
Product Number ARP55797_P050
Product Page www.avivasysbio.com/tmco4-antibody-c-terminal-region-arp55797-p050.html
Name TMCO4 Antibody - C-terminal region (ARP55797_P050)
Protein Size (# AA) 634 amino acids
Molecular Weight 68kDa
NCBI Gene Id 255104
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transmembrane and coiled-coil domains 4
Alias Symbols DKFZp686C23231, RP5-1056L3.6
Peptide Sequence Synthetic peptide located within the following region: WPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of TMCO4 remains unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TMCO4 (ARP55797_P050) antibody
Blocking Peptide For anti-TMCO4 (ARP55797_P050) antibody is Catalog # AAP55797 (Previous Catalog # AAPP36820)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TMCO4
Uniprot ID Q5TGY1
Protein Name Transmembrane and coiled-coil domain-containing protein 4
Protein Accession # NP_859070
Purification Affinity Purified
Nucleotide Accession # NM_181719
Tested Species Reactivity Human
Gene Symbol TMCO4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Image 1
Human ACHN
WB Suggested Anti-TMCO4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: ACHN cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com