Product Number |
ARP55797_P050 |
Product Page |
www.avivasysbio.com/tmco4-antibody-c-terminal-region-arp55797-p050.html |
Name |
TMCO4 Antibody - C-terminal region (ARP55797_P050) |
Protein Size (# AA) |
634 amino acids |
Molecular Weight |
68kDa |
NCBI Gene Id |
255104 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Transmembrane and coiled-coil domains 4 |
Alias Symbols |
DKFZp686C23231, RP5-1056L3.6 |
Peptide Sequence |
Synthetic peptide located within the following region: WPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of TMCO4 remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TMCO4 (ARP55797_P050) antibody |
Blocking Peptide |
For anti-TMCO4 (ARP55797_P050) antibody is Catalog # AAP55797 (Previous Catalog # AAPP36820) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human TMCO4 |
Uniprot ID |
Q5TGY1 |
Protein Name |
Transmembrane and coiled-coil domain-containing protein 4 |
Protein Accession # |
NP_859070 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_181719 |
Tested Species Reactivity |
Human |
Gene Symbol |
TMCO4 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
Image 1 | Human ACHN
| WB Suggested Anti-TMCO4 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: ACHN cell lysate |
|
|