| Product Number |
ARP55775_P050 |
| Product Page |
www.avivasysbio.com/ccdc190-antibody-n-terminal-region-arp55775-p050.html |
| Name |
CCDC190 Antibody - N-terminal region (ARP55775_P050) |
| Protein Size (# AA) |
302 amino acids |
| Molecular Weight |
34kDa |
| NCBI Gene Id |
339512 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
coiled-coil domain containing 190 |
| Alias Symbols |
C1orf110 |
| Peptide Sequence |
Synthetic peptide located within the following region: LKVICLYHVKLLTWEQRQLQKELQRLQQAETMKKKFSSYLGNGFQKRPED |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Gregory,S.G., (2006) Nature 441 (7091), 315-321 |
| Protein Interactions |
UBC; APP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CCDC190 (ARP55775_P050) antibody |
| Blocking Peptide |
For anti-CCDC190 (ARP55775_P050) antibody is Catalog # AAP55775 (Previous Catalog # AAPP36636) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf110 |
| Uniprot ID |
Q86UF4 |
| Protein Name |
coiled-coil domain-containing protein 190 |
| Protein Accession # |
NP_848645 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_178550 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CCDC190 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93% |
| Image 1 | Human Heart
 | WB Suggested Anti-C1orf110 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart |
|
|
