FGF13 Antibody - middle region (ARP55413_P050)

• Product Number: ARP55413_P050
• Name: FGF13 Antibody - middle region (ARP55413_P050)
• Protein Size (# AA): 192 amino acids
• Molecular Weight: 21kDa
• NCBI Gene Id: 2258
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Fibroblast growth factor 13
• Alias Symbols: FGF2, FHF2, DEE90, FHF-2, FGF-13, LINC00889
• Peptide Sequence: Synthetic peptide located within the following region: PKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This gene is located in a region on chromosome X, which is associated with Borjeson-Forssman-Lehmann syndrome (BFLS), making it a possible candidate gene for familial cases of the BFLS, and for other syndromal and nonspecific forms of X-linked mental retardation mapping to this region. Alternative splicing of this gene at the 5' end results in several transcript variants encoding different isoforms with different N-termini.
• Protein Interactions: PSEN1; PRNP; SCN8A; FGF13; MAPK8IP2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FGF13 (ARP55413_P050) antibody is Catalog # AAP55413 (Previous Catalog # AAPP44422)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FGF13
• Uniprot ID: Q92913
• Protein Name: Fibroblast growth factor 13
• Sample Type Confirmation:

  FGF13 is supported by BioGPS gene expression data to be expressed in HEK293T, HeLa

• Protein Accession #: NP_378668
• Purification: Affinity Purified
• Nucleotide Accession #: NM_033642
• Tested Species Reactivity: Human
• Gene Symbol: FGF13
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-FGF13 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Jurkat cell lysate
• Image 2: Human Hela
  
  Host: Rabbit
  Target Name: FGF13
  Sample Type: Human Hela
  Antibody Dilution: 1.0ug/mlFGF13 is supported by BioGPS gene expression data to be expressed in HeLa
• Image 3: Human 293T
  
  Host: Rabbit
  Target Name: FGF13
  Sample Type: Human 293T
  Antibody Dilution: 1.0ug/mlFGF13 is supported by BioGPS gene expression data to be expressed in HEK293T