| Product Number |
ARP54517_P050 |
| Product Page |
www.avivasysbio.com/pcdh17-antibody-c-terminal-region-arp54517-p050.html |
| Name |
PCDH17 Antibody - C-terminal region (ARP54517_P050) |
| Protein Size (# AA) |
1159 amino acids |
| Molecular Weight |
124kDa |
| NCBI Gene Id |
27253 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Protocadherin 17 |
| Alias Symbols |
PCH68, PCDH68 |
| Peptide Sequence |
Synthetic peptide located within the following region: SEMGAVLEQLDHPNRDLGRESVDAEEVVREIDKLLQDCRGNDPVAVRK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Szafranski,K., Genome Biol. 8 (8), R154 (2007) |
| Description of Target |
PCDH17 contains six extracellular cadherin domains, a transmembrane domain, and a cytoplasmic tail differing from those of the classical cadherins.It may play a role in the establishment and function of specific cell-cell connections in the brain.This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The encoded protein contains six extracellular cadherin domains, a transmembrane domain, and a cytoplasmic tail differing from those of the classical cadherins. The encoded protein may play a role in the establishment and function of specific cell-cell connections in the brain. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-866 AL445288.9 90051-90916 867-4389 BC028165.1 1-3523 4390-8009 AL445216.6 89335-92954 |
| Protein Interactions |
UBQLN4; ZP3; NR1H2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PCDH17 (ARP54517_P050) antibody |
| Blocking Peptide |
For anti-PCDH17 (ARP54517_P050) antibody is Catalog # AAP54517 (Previous Catalog # AAPP31301) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human PCDH17 |
| Uniprot ID |
O14917 |
| Protein Name |
Protocadherin-17 |
| Protein Accession # |
NP_001035519 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001040429 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PCDH17 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-PCDH17 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
|
|
