| Product Number |
ARP53122_P050 |
| Product Page |
www.avivasysbio.com/c22orf25-antibody-n-terminal-region-arp53122-p050.html |
| Name |
C22orf25 Antibody - N-terminal region (ARP53122_P050) |
| Protein Size (# AA) |
276 amino acids |
| Molecular Weight |
31kDa |
| NCBI Gene Id |
128989 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Chromosome 22 open reading frame 25 |
| Alias Symbols |
MECRCN, C22orf25 |
| Peptide Sequence |
Synthetic peptide located within the following region: MCIIFFKFDPRPVSKNAYRLILAANRDEFYSRPSKLADFWGNNNEILSGL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Collins,J.E., Genome Biol. 5 (10), R84 (2004) |
| Description of Target |
The exact functions of C22orf25 remain unknown. |
| Protein Interactions |
SCO2; PNLIPRP2; ELAVL1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TANGO2 (ARP53122_P050) antibody |
| Blocking Peptide |
For anti-TANGO2 (ARP53122_P050) antibody is Catalog # AAP53122 (Previous Catalog # AAPP35604) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human C22orf25 |
| Uniprot ID |
Q6ICL3 |
| Protein Name |
Uncharacterized protein C22orf25 |
| Protein Accession # |
NP_690870 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152906 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TANGO2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
| Image 1 | Human Muscle
 | WB Suggested Anti-C22orf25 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Muscle |
| | Image 2 | Human lung, Human liver
 | Host: Rabbit
Target: TANGO2
Positive control (+): Human lung (LU)
Negative control (-): Human liver (LI)
Antibody concentration: 3ug/ml |
|
|
