| Product Number |
ARP52270_P050 |
| Product Page |
www.avivasysbio.com/centa1-antibody-c-terminal-region-arp52270-p050.html |
| Name |
Centa1 Antibody - C-terminal region (ARP52270_P050) |
| Protein Size (# AA) |
302 amino acids |
| Molecular Weight |
33kDa |
| NCBI Gene Id |
231821 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ArfGAP with dual PH domains 1 |
| Alias Symbols |
Cent, GC1L, Centa1, p42IP4, 4930431P11Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: ARFHYLQVAFPGASDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTM |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Adap1 (ARP52270_P050) antibody |
| Blocking Peptide |
For anti-Adap1 (ARP52270_P050) antibody is Catalog # AAP52270 (Previous Catalog # AAPP44031) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q8BVR8 |
| Protein Name |
Centaurin, alpha 1, isoform CRA_b EMBL EDL19162.1 |
| Protein Accession # |
NP_766311 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_172723 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Adap1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100% |
| Image 1 | Mouse Kidney
 | WB Suggested Anti-Centa1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Mouse Kidney |
|
|
