MBNL2 Antibody - middle region (ARP51632_P050)

• Product Number: ARP51632_P050
• Name: MBNL2 Antibody - middle region (ARP51632_P050)
• Protein Size (# AA): 255 amino acids
• Molecular Weight: 28kDa
• NCBI Gene Id: 10150
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Muscleblind-like splicing regulator 2
• Alias Symbols: MBLL, MBLL39, PRO2032
• Peptide Sequence: Synthetic peptide located within the following region: ENGRVIACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: MBNL2 is a C3H-type zinc finger protein, which is similar to the Drosophila melanogaster muscleblind B protein.MBNL2 is a RNA-binding protein that binds to 5'ACACCC-3' core sequence. It binds to CUG triplet repeat expansion in myotonic dystrophy muscle cells by sequestering the target RNAs. MBNL2 seems to regulate expression and localization of ITGA3 by transporting it from the nucleus to cytoplasm. It may play a role in myotonic dystrophy pathophysiology (DM).
• Protein Interactions: BMI1; ELAVL1; UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MBNL2 (ARP51632_P050) antibody is Catalog # AAP51632 (Previous Catalog # AAPP30130)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MBNL2
• Uniprot ID: O95205
• Protein Name: Muscleblind-like 2 (Drosophila), isoform CRA_b EMBL EAX08969.1
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that MBNL2 is expressed in HeLa

• Protein Accession #: NP_005748
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005757
• Tested Species Reactivity: Human
• Gene Symbol: MBNL2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Image 1: Human Fetal Brain
  
  Host: Rabbit
  Target Name: MBNL2
  Sample Type: Human Fetal Brain
  Antibody Dilution: 1.0ug/ml
• Image 2: Human Fetal Heart
  
  Host: Rabbit
  Target Name: MBNL2
  Sample Type: Human Fetal Heart
  Antibody Dilution: 1.0ug/ml
• Image 3: Human Hela
  
  Host: Rabbit
  Target Name: MBNL2
  Sample Type: Hela
  Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that MBNL2 is expressed in HeLa
• Image 4: Human Brain
  
  WB Suggested Anti-MBNL2 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Human brain