| Product Number |
ARP50217_P050 |
| Product Page |
www.avivasysbio.com/tmem132b-antibody-middle-region-arp50217-p050.html |
| Name |
TMEM132B Antibody - middle region (ARP50217_P050) |
| Protein Size (# AA) |
1078 amino acids |
| Molecular Weight |
119kDa |
| NCBI Gene Id |
114795 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Transmembrane protein 132B |
| Alias Symbols |
KIAA1786, KIAA1906 |
| Peptide Sequence |
Synthetic peptide located within the following region: VQEWFHRGTPVGQEESTNKSTTPQSPMEGKNKLLKSGGPDAFTSFPTQGK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
TMEM132B single-pass type I membrane protein. It belongs to the TMEM132 family. The exact function of TMEM132B is not known. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TMEM132B (ARP50217_P050) antibody |
| Blocking Peptide |
For anti-TMEM132B (ARP50217_P050) antibody is Catalog # AAP50217 (Previous Catalog # AAPP29670) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TMEM132B |
| Uniprot ID |
Q14DG7 |
| Protein Name |
Transmembrane protein 132B |
| Protein Accession # |
NP_443139 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_052907 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TMEM132B |
| Predicted Species Reactivity |
Human, Mouse, Cow, Dog, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 77%; Horse: 93%; Human: 100%; Mouse: 79% |
| Image 1 | Human HeLa
 | WB Suggested Anti-TMEM132B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate |
|
|
