MARC1 Antibody - C-terminal region (ARP49748_P050)

• Product Number: ARP49748_P050
• Name: MARC1 Antibody - C-terminal region (ARP49748_P050)
• Protein Size (# AA): 337 amino acids
• Molecular Weight: 37kDa
• NCBI Gene Id: 64757
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: mitochondrial amidoxime reducing component 1
• Alias Symbols: MARC1, MOSC1
• Peptide Sequence: Synthetic peptide located within the following region: WDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQCDPS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321
• Protein Interactions: PARK2; UBC; SLC25A46; RAB6C; MRPL39; MRPL15; ZC3H4; PDHX; SDHA; NDUFS4; NDUFB10; NDUFB4; ATP6V1B1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MARC1 (ARP49748_P050) antibody is Catalog # AAP49748 (Previous Catalog # AAPP29330)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MOSC1
• Uniprot ID: Q5VT66
• Protein Name: mitochondrial amidoxime-reducing component 1
• Protein Accession #: NP_073583
• Purification: Affinity Purified
• Nucleotide Accession #: NM_022746
• Tested Species Reactivity: Human
• Gene Symbol: MARC1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Image 1: Human Placenta
  
  WB Suggested Anti-MOSC1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Human Placenta