CDH23 Antibody - middle region (ARP49690_P050)

• Product Number: ARP49690_P050
• Name: CDH23 Antibody - middle region (ARP49690_P050)
• Protein Size (# AA): 530 amino acids
• Molecular Weight: 56kDa
• NCBI Gene Id: 64072
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cadherin-related 23
• Alias Symbols: PITA5, USH1D, CDHR23
• Peptide Sequence: Synthetic peptide located within the following region: DYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Baux,D., (er) Hum. Mutat. (2008) In press
• Description of Target: This gene is a member of the cadherin superfamily, whose genes encode calcium dependent cell-cell adhesion glycoproteins. The encoded protein is thought to be involved in stereocilia organization and hair bundle formation. The gene is located in a region
• Protein Interactions: LYN; Dlg4; USH1C; MYO7A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CDH23 (ARP49690_P050) antibody is Catalog # AAP49690 (Previous Catalog # AAPP29271)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CDH23
• Uniprot ID: Q9H251
• Protein Name: Cadherin-23
• Protein Accession #: NP_443068
• Purification: Affinity Purified
• Nucleotide Accession #: NM_052836
• Tested Species Reactivity: Human
• Gene Symbol: CDH23
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Image 1: Human OVCAR-3
  
  WB Suggested Anti-CDH23 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: OVCAR-3 cell lysate