| Product Number |
ARP48944_P050 |
| Product Page |
www.avivasysbio.com/b3gnt4-antibody-n-terminal-region-arp48944-p050.html |
| Name |
B3GNT4 Antibody - N-terminal region (ARP48944_P050) |
| Protein Size (# AA) |
378 amino acids |
| Molecular Weight |
42kDa |
| NCBI Gene Id |
79369 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 |
| Alias Symbols |
B3GN-T4, beta3Gn-T4 |
| Peptide Sequence |
Synthetic peptide located within the following region: MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Shiraishi,N., (2001) J. Biol. Chem. 276 (5), 3498-3507 |
| Description of Target |
B3GNT4 is a member of the beta-1,3-N-acetylglucosaminyltransferase protein family. The protein is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate. It is a type II transmembrane protein.This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase protein family. The encoded enzyme is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate. It is a type II transmembrane protein. |
| Protein Interactions |
CUL4B; GOLM1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-B3GNT4 (ARP48944_P050) antibody |
| Blocking Peptide |
For anti-B3GNT4 (ARP48944_P050) antibody is Catalog # AAP48944 (Previous Catalog # AAPP28991) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human B3GNT4 |
| Uniprot ID |
Q9C0J1 |
| Protein Name |
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 |
| Protein Accession # |
NP_110392 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_030765 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
B3GNT4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 92%; Rat: 86% |
| Image 1 | Human 293T
 | WB Suggested Anti-B3GNT4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate |
|
|
