| Product Number |
ARP47678_P050 |
| Product Page |
www.avivasysbio.com/irx6-antibody-middle-region-arp47678-p050.html |
| Name |
Irx6 Antibody - middle region (ARP47678_P050) |
| Protein Size (# AA) |
443 amino acids |
| Molecular Weight |
47kDa |
| NCBI Gene Id |
307715 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Iroquois homeobox 6 |
| Alias Symbols |
RGD1564830 |
| Peptide Sequence |
Synthetic peptide located within the following region: RLKKENKMTWVPKNKGGEERKADGGGEDALGCLNGDTKDATASQEAQGLQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Irx6 (ARP47678_P050) antibody |
| Blocking Peptide |
For anti-Irx6 (ARP47678_P050) antibody is Catalog # AAP47678 (Previous Catalog # AAPP28538) |
| Uniprot ID |
D4A7R4 |
| Protein Name |
Protein Irx6 Ensembl ENSRNOP00000014831 |
| Protein Accession # |
NP_001095883 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001102413 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Irx6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Mouse: 86%; Rabbit: 92%; Rat: 92% |
| Image 1 | Rat Muscle
 | WB Suggested Anti-Irx6 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Muscle |
|
|
