| Product Number |
ARP47657_P050 |
| Product Page |
www.avivasysbio.com/selenon-antibody-c-terminal-region-arp47657-p050.html |
| Name |
SELENON Antibody - C-terminal region (ARP47657_P050) |
| Protein Size (# AA) |
557 amino acids |
| Molecular Weight |
62kDa |
| NCBI Gene Id |
74777 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
selenoprotein N |
| Alias Symbols |
Se, SelN, Sepn1, AI414492, 1110019I12Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: VHHINANYFLDITSMKPEDMENNNVFSFSSSFEDPSTATYMQFLREGLRR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a glycoprotein that is localized in the endoplasmic reticulum. It plays an important role in cell protection against oxidative stress, and in the regulation of redox-related calcium homeostasis. Mutations in the orthologous gene in human are associated with early onset muscle disorders, referred to as SEPN1-related myopathy. Knockout mice deleted for this gene exhibit abnormal lung development. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec). Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. A second stop-codon redefinition element (SRE) adjacent to the UGA codon has been identified in this gene (PMID:15791204). SRE is a phylogenetically conserved stem-loop structure that stimulates readthrough at the UGA codon, and augments the Sec insertion efficiency by SECIS. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SELENON (ARP47657_P050) antibody |
| Additional Information |
IHC Information: Human Skeletal Muscle: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Skeletal Muscle: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Skin: Formalin-Fixed, Paraffin-Embedded (FFPE) |
| Blocking Peptide |
For anti-SELENON (ARP47657_P050) antibody is Catalog # AAP47657 (Previous Catalog # AAPP28518) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
D3Z5N3 |
| Protein Name |
selenoprotein N |
| Protein Accession # |
NP_083376 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_029100 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
SELENON |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rat: 86% |
| Image 1 | Mouse Heart
 | WB Suggested Anti-Sepn1 Antibody Titration: 1 ug/ml
Positive Control: Mouse Heart lysate |
|
|
