AK2 Antibody - N-terminal region (ARP46059_T100)

• Product Number: ARP46059_T100
• Name: AK2 Antibody - N-terminal region (ARP46059_T100)
• Protein Size (# AA): 239 amino acids
• Molecular Weight: 26kDa
• NCBI Gene Id: 204
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Adenylate kinase 2
• Alias Symbols: ADK2
• Peptide Sequence: Synthetic peptide located within the following region: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDML
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kohler,C., (1999) FEBS Lett. 447 (1), 10-12
• Description of Target: Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis.Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Two transcript variants encoding distinct isoforms have been identified for this gene.
• Protein Interactions: HUWE1; UBC; MDM2; BAG3; ABCC5; ABCC6; TUFM; SAFB; MRPL12; IDH1; DSP; DLD; RAVER1; TELO2; CUL3; SHBG; SUMO2; MEPCE;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-AK2 (ARP46059_T100) antibody is Catalog # AAP46059 (Previous Catalog # AAPS17205)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AK2
• Uniprot ID: P54819
• Protein Name: Adenylate kinase 2, mitochondrial
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that AK2 is expressed in HepG2

• Protein Accession #: NP_001616
• Purification: Protein A purified
• Nucleotide Accession #: NM_001625
• Tested Species Reactivity: Human
• Gene Symbol: AK2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Image 1: Human HepG2
  
  WB Suggested Anti-AK2 Antibody Titration: 2.5ug/ml
  Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that AK2 is expressed in HepG2