NR1I3 Antibody - N-terminal region (ARP45623_T100)

Data Sheet
 
Product Number ARP45623_T100
Product Page www.avivasysbio.com/nr1i3-antibody-n-terminal-region-arp45623-t100.html
Name NR1I3 Antibody - N-terminal region (ARP45623_T100)
Protein Size (# AA) 348 amino acids
Molecular Weight 39kDa
NCBI Gene Id 9970
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Nuclear receptor subfamily 1, group I, member 3
Alias Symbols CAR, CAR1, MB67
Peptide Sequence Synthetic peptide located within the following region: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ferguson,S.S., (2005) Mol. Pharmacol. 68 (3), 747-757
Description of Target NR1I3 mediates the induction of transcription of cytochrome P450 (CYP) genes by phenobarbital (PB) and PB-type inducers. NR1I3 activation induces hepatic expression of detoxification enzymes and transporters and increases liver size. NR1I3 can also regulate both liver homeostasis and tumorigenesis in response to xenobiotic stresses.
Protein Interactions HSP90AA1; RXRA; CHD9; SNX13; SNRPD3; IGH; PSMC5; PSMC4; EIF3I; SRC; MAP4; FTH1; HNF4A; NR0B2; PPARGC1A; MED1; NCOA1; POU1F1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NR1I3 (ARP45623_T100) antibody
Blocking Peptide For anti-NR1I3 (ARP45623_T100) antibody is Catalog # AAP45623 (Previous Catalog # AAPP11906)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NR1I3
Uniprot ID Q5VTW5
Protein Name Nuclear receptor subfamily 1 group I member 3
Protein Accession # NP_005113
Purification Protein A purified
Nucleotide Accession # NM_005122
Tested Species Reactivity Human
Gene Symbol NR1I3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 90%; Dog: 92%; Guinea Pig: 79%; Human: 100%; Mouse: 92%; Pig: 100%; Rat: 92%
Image 1
Human Liver
Human Liver
Image 2
Human Liver
WB Suggested Anti-NR1I3 Antibody Titration: 1.25ug/ml
Positive Control: Human Liver
Image 3
Human liver, Human stomach
Host: Rabbit
Target: NR1I3
Positive control (+): Human liver (LI)
Negative control (-): Human stomach (ST)
Antibody concentration: 5ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com