| Product Number |
ARP45164_P050 |
| Product Page |
www.avivasysbio.com/btn1a1-antibody-n-terminal-region-arp45164-p050.html |
| Name |
BTN1A1 Antibody - N-terminal region (ARP45164_P050) |
| Protein Size (# AA) |
526 amino acids |
| Molecular Weight |
56kDa |
| NCBI Gene Id |
696 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Butyrophilin, subfamily 1, member A1 |
| Alias Symbols |
BT, BTN, BTN1 |
| Peptide Sequence |
Synthetic peptide located within the following region: LPCRLSPNASAEHLELRWFRKKVSPAVLVHRDGREQEAEQMPEYRGRATL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
McManaman,J.L., J. Physiol. (Lond.) 545 (PT 2), 567-579 (2002) |
| Description of Target |
Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families.Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families. |
| Protein Interactions |
TRIM68; PLK1; XDH; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-BTN1A1 (ARP45164_P050) antibody |
| Blocking Peptide |
For anti-BTN1A1 (ARP45164_P050) antibody is Catalog # AAP45164 (Previous Catalog # AAPP26153) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human BTN1A1 |
| Uniprot ID |
Q13410 |
| Protein Name |
Butyrophilin subfamily 1 member A1 |
| Protein Accession # |
NP_001723 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001732 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
BTN1A1 |
| Predicted Species Reactivity |
Human, Rat, Dog, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 93%; Horse: 79%; Human: 100%; Rat: 79% |
| Image 1 | Human HepG2
 | WB Suggested Anti-BTN1A1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
|
|
