ATG9A Antibody - middle region (ARP44985_P050)

Data Sheet
 
Product Number ARP44985_P050
Product Page www.avivasysbio.com/atg9a-antibody-middle-region-arp44985-p050.html
Name ATG9A Antibody - middle region (ARP44985_P050)
Protein Size (# AA) 839 amino acids
Molecular Weight 94kDa
NCBI Gene Id 79065
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name ATG9 autophagy related 9 homolog A (S. cerevisiae)
Alias Symbols mATG9, APG9L1, MGD3208
Peptide Sequence Synthetic peptide located within the following region: VASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Olsen,J.V., (2006) Cell 127 (3), 635-648
Description of Target ATG9A belongs to the ATG9 family. It plays a role in autophagy.
Protein Interactions NOTCH2NL; KRTAP10-8; LONRF1; KRTAP4-2; UBE3A; UBC; REL; KRT31; KRTAP5-9; TBK1; MAPK6; SRCAP;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ATG9A (ARP44985_P050) antibody
Blocking Peptide For anti-ATG9A (ARP44985_P050) antibody is Catalog # AAP44985 (Previous Catalog # AAPP26065)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ATG9A
Uniprot ID Q3ZAQ6
Protein Name Autophagy-related protein 9A
Protein Accession # NP_001070666
Purification Affinity Purified
Nucleotide Accession # NM_001077198
Tested Species Reactivity Human
Gene Symbol ATG9A
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 77%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Rabbit: 92%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-ATG9A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com