Product Number |
ARP44945_P050 |
Product Page |
www.avivasysbio.com/acbd5-antibody-c-terminal-region-arp44945-p050.html |
Name |
ACBD5 Antibody - C-terminal region (ARP44945_P050) |
Protein Size (# AA) |
490 amino acids |
Molecular Weight |
55kDa |
NCBI Gene Id |
91452 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Acyl-CoA binding domain containing 5 |
Alias Symbols |
RDLKD |
Peptide Sequence |
Synthetic peptide located within the following region: VRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ohara,O., (2002) DNA Res. 9 (2), 47-57 |
Description of Target |
ACBD5 contains 1 ACB (acyl-CoA-binding) domain. The function of the ACBD5 protein is not known. |
Protein Interactions |
FBXW11; vpr; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ACBD5 (ARP44945_P050) antibody |
Blocking Peptide |
For anti-ACBD5 (ARP44945_P050) antibody is Catalog # AAP44945 (Previous Catalog # AAPP26026) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ACBD5 |
Uniprot ID |
Q5T8D3 |
Protein Name |
Acyl-CoA-binding domain-containing protein 5 |
Protein Accession # |
NP_001035938 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001042473 |
Tested Species Reactivity |
Human |
Gene Symbol |
ACBD5 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | Human Brain
| WB Suggested Anti-ACBD5 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human brain |
|
|