ACBD5 Antibody - N-terminal region (ARP44943_P050)

• Product Number: ARP44943_P050
• Name: ACBD5 Antibody - N-terminal region (ARP44943_P050)
• Protein Size (# AA): 490 amino acids
• Molecular Weight: 55kDa
• NCBI Gene Id: 91452
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Acyl-CoA binding domain containing 5
• Alias Symbols: RDLKD
• Peptide Sequence: Synthetic peptide located within the following region: ADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ohara,O., (2002) DNA Res. 9 (2), 47-57
• Description of Target: ACBD5 contains 1 ACB (acyl-CoA-binding) domain. The function of the ACBD5 protein is not known.
• Protein Interactions: FBXW11; vpr; UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ACBD5 (ARP44943_P050) antibody is Catalog # AAP44943 (Previous Catalog # AAPP26024)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACBD5
• Uniprot ID: Q5T8D3
• Protein Name: Acyl-CoA-binding domain-containing protein 5
• Protein Accession #: NP_001035938
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001042473
• Tested Species Reactivity: Human
• Gene Symbol: ACBD5
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Brain
  
  WB Suggested Anti-ACBD5 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human brain