| Product Number |
ARP44656_P050 |
| Product Page |
www.avivasysbio.com/gm13178-antibody-c-terminal-region-arp44656-p050.html |
| Name |
Gm13178 Antibody - C-terminal region (ARP44656_P050) |
| Protein Size (# AA) |
408 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
546849 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Predicted gene 13178 |
| Alias Symbols |
Gm437, Gm13178 |
| Peptide Sequence |
Synthetic peptide located within the following region: TFLVSCEHDVLRDDALLYKKRLEDQGVPVSWYHAEDGFHGCISLFDKQPF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Gm13178 (ARP44656_P050) antibody |
| Blocking Peptide |
For anti-Gm13178 (ARP44656_P050) antibody is Catalog # AAP44656 (Previous Catalog # AAPP12128) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
B1AVU7 |
| Protein Name |
Novel protein similar to arylacetamide deacetylase-like 4 Aadacl4 EMBL CAM14865.1 |
| Protein Accession # |
NP_001079005 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001085536 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Gm13178 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 92%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 86%; Rat: 92% |
| Image 1 | Mouse Kidney
 | WB Suggested Anti-Gm13178 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Kidney |
|
|
