| Product Number |
ARP44552_P050 |
| Product Page |
www.avivasysbio.com/cisd2-antibody-n-terminal-region-arp44552-p050.html |
| Name |
CISD2 Antibody - N-terminal region (ARP44552_P050) |
| Protein Size (# AA) |
135 amino acids |
| Molecular Weight |
15kDa |
| NCBI Gene Id |
493856 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
CDGSH iron sulfur domain 2 |
| Alias Symbols |
ERIS, WFS2, ZCD2, NAF-1, Miner1 |
| Peptide Sequence |
Synthetic peptide located within the following region: VLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Amr,S., (2007) Am. J. Hum. Genet. 81 (4), 673-683 |
| Description of Target |
CISD2 is a zinc finger protein that localizes to the endoplasmic reticulum. It binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2 (WFS2). |
| Protein Interactions |
UBC; LMNA; APP; SPP1; BCL2; ELAVL1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CISD2 (ARP44552_P050) antibody |
| Blocking Peptide |
For anti-CISD2 (ARP44552_P050) antibody is Catalog # AAP44552 (Previous Catalog # AAPP12068) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CISD2 |
| Uniprot ID |
Q8N5K1 |
| Protein Name |
CDGSH iron-sulfur domain-containing protein 2 |
| Protein Accession # |
NP_001008389 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001008388 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CISD2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 82% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-CISD2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T |
|
| Image 2 | Human HCT116 Whole Cell
 | Host: Rabbit
Target Name: CISD2
Sample Tissue: Human HCT116 Whole Cell
Antibody Dilution: 1ug/ml |
|
