| Product Number |
ARP44449_T100 |
| Product Page |
www.avivasysbio.com/c6orf21-antibody-n-terminal-region-arp44449-t100.html |
| Name |
C6orf21 Antibody - N-terminal region (ARP44449_T100) |
| Protein Size (# AA) |
297 amino acids |
| Molecular Weight |
32kDa |
| NCBI Gene Id |
259215 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Lymphocyte antigen 6 complex, locus G6F |
| Alias Symbols |
G6f, NG32, LY6G6, LY6G6D, C6orf21 |
| Peptide Sequence |
Synthetic peptide located within the following region: CSPAAGSFTTLVAQVQVGRPAPDPGKPGRESRLRLLGNYSLWLEGSKEED |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
De Biochem. J. 375 (PT 1), 207-213 (2003) |
| Description of Target |
The function remains unknown. |
| Protein Interactions |
GRB7; GRB2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LY6G6F (ARP44449_T100) antibody |
| Blocking Peptide |
For anti-LY6G6F (ARP44449_T100) antibody is Catalog # AAP44449 (Previous Catalog # AAPP25759) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf21 |
| Uniprot ID |
Q7Z5H2 |
| Protein Name |
Lymphocyte antigen 6 complex locus protein G6f |
| Protein Accession # |
NP_001003693 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001003693 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LY6G6F |
| Predicted Species Reactivity |
Human, Dog |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 85%; Human: 100% |
| Image 1 | Human kidney
 | Human kidney |
| | Image 2 | Human HepG2
 | WB Suggested Anti-C6orf21 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate |
| | Image 3 | 293T Cell Lysate, Human Ovary Tumor
 | Host: Rabbit
Target: LY6G6F
Positive control (+): 293T Cell Lysate (2T)
Negative control (-): Human Ovary Tumor (T-OV)
Antibody concentration: 1ug/ml |
|
|
