| Product Number |
ARP44028_P050 |
| Product Page |
www.avivasysbio.com/slc26a1-antibody-c-terminal-region-arp44028-p050.html |
| Name |
SLC26A1 Antibody - C-terminal region (ARP44028_P050) |
| Protein Size (# AA) |
701 amino acids |
| Molecular Weight |
77kDa |
| NCBI Gene Id |
10861 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Solute carrier family 26 (sulfate transporter), member 1 |
| Alias Symbols |
CAON, EDM4, SAT1, SAT-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: LYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRAALVPAAA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Regeer,R.R., (2003) DNA Cell Biol. 22 (2), 107-117 |
| Description of Target |
SLC26A1 is a member of sulfate/anion transporter family. Family members are well conserved in their protein (aa length among species) structures, but have markedly different tissue expression patterns. Its gene is primarily expressed in the liver, pancreas, and brain.This gene is a member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures, but have markedly different tissue expression patterns. This gene is primarily expressed in the liver, pancreas, and brain. Three splice variants that encode different isoforms have been identified. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SLC26A1 (ARP44028_P050) antibody |
| Blocking Peptide |
For anti-SLC26A1 (ARP44028_P050) antibody is Catalog # AAP44028 (Previous Catalog # AAPP11769) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human SLC26A1 |
| Uniprot ID |
Q9H2B4 |
| Protein Name |
Sulfate anion transporter 1 |
| Protein Accession # |
NP_071325 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_022042 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLC26A1 |
| Predicted Species Reactivity |
Human |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-SLC26A1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
| | Image 2 | Human Skin
 | Human Skin |
|
|
