SLC17A4 Antibody - middle region (ARP43906_P050)

• Product Number: ARP43906_P050
• Name: SLC17A4 Antibody - middle region (ARP43906_P050)
• Protein Size (# AA): 497 amino acids
• Molecular Weight: 55kDa
• NCBI Gene Id: 10050
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Solute carrier family 17 (sodium phosphate), member 4
• Alias Symbols: KAIA2138
• Peptide Sequence: Synthetic peptide located within the following region: YFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Elmariah,S. Am. J. Physiol., Cell Physiol. 285 (2), C446-C456 (2003)
• Description of Target: As a Na/PO4 cotransporter, SLC17A4 may be important to the regulation of Li transport and its therapeutic effects.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SLC17A4 (ARP43906_P050) antibody is Catalog # AAP43906 (Previous Catalog # AAPP25441)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC17A4
• Uniprot ID: Q9Y2C5
• Protein Name: Putative small intestine sodium-dependent phosphate transport protein
• Protein Accession #: NP_005486
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005495
• Tested Species Reactivity: Human
• Gene Symbol: SLC17A4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-SLC17A4 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysate
• Image 2: Human Muscle
  
  Human Muscle