SLC25A25 Antibody - N-terminal region (ARP43761_P050)

• Product Number: ARP43761_P050
• Name: SLC25A25 Antibody - N-terminal region (ARP43761_P050)
• Protein Size (# AA): 503 amino acids
• Molecular Weight: 55kDa
• NCBI Gene Id: 114789
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25
• Alias Symbols: MCSC, PCSCL, SCAMC-2
• Peptide Sequence: Synthetic peptide located within the following region: AVGLRRLGLHRTEGELQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Fiermonte,G., (2004) J. Biol. Chem. 279 (29), 30722-30730
• Description of Target: The function remains unknown.
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SLC25A25 (ARP43761_P050) antibody is Catalog # AAP43761 (Previous Catalog # AAPP25351)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A25
• Uniprot ID: Q6KCM6
• Protein Name: Calcium-binding mitochondrial carrier protein SCaMC-2
• Protein Accession #: NP_001006642
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001006641
• Tested Species Reactivity: Human
• Gene Symbol: SLC25A25
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-SLC25A25 Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysate
• Image 2: Human PANC1 Whole Cell
  
  Host: Rabbit
  Target Name: SLC25A25
  Sample Tissue: Human PANC1 Whole Cell
  Antibody Dilution: 1ug/ml