| Product Number |
ARP43608_T100 |
| Product Page |
www.avivasysbio.com/irf6-antibody-c-terminal-region-arp43608-t100.html |
| Name |
IRF6 Antibody - C-terminal region (ARP43608_T100) |
| Protein Size (# AA) |
591 amino acids |
| Molecular Weight |
65kDa |
| NCBI Gene Id |
3664 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Interferon regulatory factor 6 |
| Alias Symbols |
LPS, PIT, PPS, VWS, OFC6, PPS1, VWS1 |
| Peptide Sequence |
Synthetic peptide located within the following region: FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVAR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Beausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135 |
| Description of Target |
IRF6 is a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in its gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation.The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction. |
| Protein Interactions |
HHV8GK18_gp81; UBC; BNC2; IRF5; IRF8; ZBTB3; RFX3; TLX2; LBP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-IRF6 (ARP43608_T100) antibody |
| Blocking Peptide |
For anti-IRF6 (ARP43608_T100) antibody is Catalog # AAP43039 (Previous Catalog # AAPP11246) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human IRF6 |
| Uniprot ID |
O14896 |
| Protein Name |
Interferon regulatory factor 6 |
| Protein Accession # |
NP_006138 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_004661 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
IRF6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-IRF6 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate |
|
