GOT2 antibody - N-terminal region (ARP43517_T100)
Data Sheet
Product Number ARP43517_T100
Product Page
Product Name GOT2 antibody - N-terminal region (ARP43517_T100)
Gene Symbol GOT2
Protein Size (# AA) 430 amino acids
Molecular Weight 45kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Official Gene Full Name Glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)
Alias Symbols FLJ40994, kat4, kativ, mitaat, KAT4, KATIV, mitAAT
NCBI Gene Id 2806
Host Rabbit
Clonality Polyclonal
Size 100 ul
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Description This is a rabbit polyclonal antibody against GOT2. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: PPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAA
Target Reference Suzuki,Y., Gene 200 (1-2), 149-156 (1997)
Description of Target Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.
Protein Interactions FUS; UBC; NEDD8; MDM2; CDK2; CCL21; GLRX; GAPDH; APCS; AI837181; HDAC5; PSMD4; THOC7; ZDHHC6; GLUD1; HSPA8; PC; MDH2; CTNNBIP1; MPG;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-GOT2 (ARP43517_T100) antibody is Catalog # AAP43517 (Previous Catalog # AAPS15710)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GOT2
Complete computational species homology data Anti-GOT2 (ARP43517_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GOT2.
Swissprot Id P00505
Protein Name Aspartate aminotransferase, mitochondrial
Protein Accession # NP_002071
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GOT2.
Nucleotide Accession # NM_002080
Conjugation Options

ARP43517_T100-FITC Conjugated

ARP43517_T100-HRP Conjugated

ARP43517_T100-Biotin Conjugated

Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Image 1
Human 293T
WB Suggested Anti-GOT2 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |