FBXL5 Antibody - middle region (ARP43104_T100)

• Product Number: ARP43104_T100
• Name: FBXL5 Antibody - middle region (ARP43104_T100)
• Protein Size (# AA): 691 amino acids
• Molecular Weight: 76kDa
• NCBI Gene Id: 26234
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: F-box and leucine-rich repeat protein 5
• Alias Symbols: FBL4, FBL5, FLR1
• Peptide Sequence: Synthetic peptide located within the following region: VHWARGDWYSGPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEES
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ilyin,G.P., (2000) Genomics 67 (1), 40-47
• Description of Target: FBXL5 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXL5 belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats.This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats. Alternative splicing of this gene generates 2 transcript variants.
• Protein Interactions: NABP2; CUL1; SNAI1; SKP1; FBXL5; HERC2; UBC; IREB2; ACO1; RBX1; MUS81; MMS19; FAM96B; ORC4; EP300; SMURF1; BTG1; COPS5; PLK1; CSNK2B; DCTN1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FBXL5 (ARP43104_T100) antibody is Catalog # AAP43104 (Previous Catalog # AAPP25076)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FBXL5
• Uniprot ID: Q9UKA1
• Protein Name: F-box/LRR-repeat protein 5
• Protein Accession #: NP_036293
• Purification: Protein A purified
• Nucleotide Accession #: NM_012161
• Tested Species Reactivity: Human
• Gene Symbol: FBXL5
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 93%
• Image 1: Human Muscle
  
  Human Muscle
• Image 2: Human HepG2
  
  WB Suggested Anti-FBXL5 Antibody Titration: 5.0ug/ml
  Positive Control: HepG2 cell lysate