Product Number |
ARP43077_P050 |
Product Page |
www.avivasysbio.com/rfpl3-antibody-c-terminal-region-arp43077-p050.html |
Name |
RFPL3 Antibody - C-terminal region (ARP43077_P050) |
Protein Size (# AA) |
288 amino acids |
Molecular Weight |
32kDa |
NCBI Gene Id |
10738 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Ret finger protein-like 3 |
Alias Symbols |
RNF120 |
Peptide Sequence |
Synthetic peptide located within the following region: TVPLTFLLVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Collins,J.E., Genome Biol. 5 (10), R84 (2004) |
Description of Target |
The function remains unknown. |
Protein Interactions |
LNX1; UBE2I; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-RFPL3 (ARP43077_P050) antibody |
Blocking Peptide |
For anti-RFPL3 (ARP43077_P050) antibody is Catalog # AAP43077 (Previous Catalog # AAPP25053) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human RFPL3 |
Uniprot ID |
Q8N5R4 |
Protein Name |
Ret finger protein-like 3 EMBL AAH31689.1 |
Protein Accession # |
NP_006595 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006604 |
Tested Species Reactivity |
Human |
Gene Symbol |
RFPL3 |
Predicted Species Reactivity |
Human, Rat |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100%; Rat: 77% |
Image 1 | Human HepG2
| WB Suggested Anti-RFPL3 Antibody Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysate |
|
|