| Product Number |
ARP42874_P050 |
| Product Page |
www.avivasysbio.com/parp8-antibody-n-terminal-region-arp42874-p050.html |
| Name |
Parp8 Antibody - N-terminal region (ARP42874_P050) |
| Protein Size (# AA) |
891 amino acids |
| Molecular Weight |
99kDa |
| NCBI Gene Id |
52552 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Poly (ADP-ribose) polymerase family, member 8 |
| Alias Symbols |
ARTD16, D13Ertd275, D13Ertd275e, 2810430O08Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: ITSETTSPSAPASARGIYLMGMCSRQERIQKDIDVVIQKSRAEKDCLFAD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of Parp8 remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Parp8 (ARP42874_P050) antibody |
| Blocking Peptide |
For anti-Parp8 (ARP42874_P050) antibody is Catalog # AAP42874 (Previous Catalog # AAPS10904) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human Parp8 |
| Uniprot ID |
Q3UD82 |
| Protein Accession # |
NP_001074478 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001081009 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Parp8 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Mouse Kidney
 | WB Suggested Anti-Parp8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Mouse Kidney |
|
|
