| Product Number |
ARP42751_T100 |
| Product Page |
www.avivasysbio.com/fam174b-antibody-c-terminal-region-arp42751-t100.html |
| Name |
FAM174B Antibody - C-terminal region (ARP42751_T100) |
| Protein Size (# AA) |
157 amino acids |
| Molecular Weight |
17kDa |
| NCBI Gene Id |
400451 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Family with sequence similarity 174, member B |
| Alias Symbols |
MGC102891 |
| Peptide Sequence |
Synthetic peptide located within the following region: FTTLLIACLLLRVFRSGKRLKKTRKYDIITTPAERVEMAPLNEEDDEDED |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Otsuki,T., (2005) DNA Res. 12 (2), 117-126 |
| Description of Target |
The function remains unknown. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FAM174B (ARP42751_T100) antibody |
| Blocking Peptide |
For anti-FAM174B (ARP42751_T100) antibody is Catalog # AAP42751 (Previous Catalog # AAPP24974) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human LOC400451 |
| Uniprot ID |
Q3ZCQ3 |
| Protein Name |
Membrane protein FAM174B |
| Protein Accession # |
NP_997329 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_207446 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FAM174B |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Yeast, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 79% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-FAM174B Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate |
| | Image 2 | Human kidney
 | Human kidney |
|
|
