Product Number |
ARP42751_T100 |
Product Page |
www.avivasysbio.com/fam174b-antibody-c-terminal-region-arp42751-t100.html |
Name |
FAM174B Antibody - C-terminal region (ARP42751_T100) |
Protein Size (# AA) |
157 amino acids |
Molecular Weight |
17kDa |
NCBI Gene Id |
400451 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Family with sequence similarity 174, member B |
Alias Symbols |
MGC102891 |
Peptide Sequence |
Synthetic peptide located within the following region: FTTLLIACLLLRVFRSGKRLKKTRKYDIITTPAERVEMAPLNEEDDEDED |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Otsuki,T., (2005) DNA Res. 12 (2), 117-126 |
Description of Target |
The function remains unknown. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests. |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-FAM174B (ARP42751_T100) antibody |
Blocking Peptide |
For anti-FAM174B (ARP42751_T100) antibody is Catalog # AAP42751 (Previous Catalog # AAPP24974) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human LOC400451 |
Uniprot ID |
Q3ZCQ3 |
Protein Name |
Membrane protein FAM174B |
Protein Accession # |
NP_997329 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_207446 |
Tested Species Reactivity |
Human |
Gene Symbol |
FAM174B |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Yeast, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 79% |
Image 1 | Human Jurkat
| WB Suggested Anti-FAM174B Antibody Titration: 1.25ug/ml Positive Control: Jurkat cell lysate |
| Image 2 | Human kidney
| Human kidney |
|
|