DNASE2B Antibody - middle region (ARP42596_P050)

Data Sheet
 
Product Number ARP42596_P050
Product Page www.avivasysbio.com/dnase2b-antibody-middle-region-arp42596-p050.html
Name DNASE2B Antibody - middle region (ARP42596_P050)
Protein Size (# AA) 357 amino acids
Molecular Weight 39kDa
NCBI Gene Id 58511
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Deoxyribonuclease II beta
Alias Symbols DLAD
Peptide Sequence Synthetic peptide located within the following region: IKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Nishimoto,S., (2003) Nature 424 (6952), 1071-1074
Description of Target DNASE2B shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this protein is restricted to the salivary gland and lungs. The protein encoded by this gene shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this gene product is restricted to the salivary gland and lungs. The gene has been localized to chromosome 1p22.3 adjacent (and in opposite orientation) to the uricase pseudogene. Two transcript variants encoding different isoforms have been described for this gene.
Protein Interactions UBC; UBD;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DNASE2B (ARP42596_P050) antibody
Blocking Peptide For anti-DNASE2B (ARP42596_P050) antibody is Catalog # AAP42596 (Previous Catalog # AAPP24832)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DNASE2B
Uniprot ID Q8WZ79
Protein Name Deoxyribonuclease-2-beta
Protein Accession # NP_067056
Purification Affinity Purified
Nucleotide Accession # NM_021233
Tested Species Reactivity Human
Gene Symbol DNASE2B
Predicted Species Reactivity Human, Rat, Cow, Guinea Pig, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Pig: 86%; Rat: 86%
Image 1
Human Placenta
WB Suggested Anti-DNASE2B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com