| Product Number |
ARP42467_T100 |
| Product Page |
www.avivasysbio.com/upb1-antibody-middle-region-arp42467-t100.html |
| Name |
UPB1 Antibody - middle region (ARP42467_T100) |
| Protein Size (# AA) |
384 amino acids |
| Molecular Weight |
42kDa |
| NCBI Gene Id |
51733 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Ureidopropionase, beta |
| Alias Symbols |
BUP1 |
| Peptide Sequence |
Synthetic peptide located within the following region: AVVISNSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
van (2004) Hum. Mol. Genet. 13 (22), 2793-2801 |
| Description of Target |
UPB1 is a protein that belongs to the CN hydrolase family. Beta-ureidopropionase catalyzes the last step in the pyrimidine degradation pathway. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta-aminoisobutyric acid, respectively. UP deficiencies are associated with N-carbamyl-beta-amino aciduria and may lead to abnormalities in neurological activityThis gene encodes a protein that belongs to the CN hydrolase family. Beta-ureidopropionase catalyzes the last step in the pyrimidine degradation pathway. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta-aminoisobutyric acid, respectively. UP deficiencies are associated with N-carbamyl-beta-amino aciduria and may lead to abnormalities in neurological activity. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-UPB1 (ARP42467_T100) antibody |
| Blocking Peptide |
For anti-UPB1 (ARP42467_T100) antibody is Catalog # AAP42467 (Previous Catalog # AAPS12706) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human UPB1 |
| Uniprot ID |
Q9UBR1 |
| Protein Name |
Beta-ureidopropionase |
| Publications |
Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). 24465277
Molecular profile of 5-fluorouracil pathway genes in colorectal carcinoma. BMC Cancer. 16, 795 (2016). 27733154 |
| Protein Accession # |
NP_057411 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_016327 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
UPB1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-UPB1 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate |
|
|
