| Product Number |
ARP42344_T100 |
| Product Page |
www.avivasysbio.com/sardh-antibody-middle-region-arp42344-t100.html |
| Name |
SARDH Antibody - middle region (ARP42344_T100) |
| Protein Size (# AA) |
918 amino acids |
| Molecular Weight |
101kDa |
| NCBI Gene Id |
1757 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Sarcosine dehydrogenase |
| Alias Symbols |
SAR, SDH, SARD, BPR-2, DMGDHL1 |
| Peptide Sequence |
Synthetic peptide located within the following region: DHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function remains known. |
| Protein Interactions |
UBE2N; FKBP4; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SARDH (ARP42344_T100) antibody |
| Additional Information |
IHC Information: HepG2 cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%. |
| Blocking Peptide |
For anti-SARDH (ARP42344_T100) antibody is Catalog # AAP42344 (Previous Catalog # AAPS12512) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SARDH |
| Uniprot ID |
Q9UL12 |
| Protein Name |
SARDH protein EMBL AAH33217.1 |
| Publications |
Khan, A. P. et al. The role of sarcosine metabolism in prostate cancer progression. Neoplasia 15, 491-501 (2013). 23633921 |
| Sample Type Confirmation |
SARDH is supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
AAH33217 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001134707 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SARDH |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human Kidney
 | Rabbit Anti-SARDH Antibody
Catalog Number: ARP42344
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 2 | Human HepG2
 | WB Suggested Anti-SARDH Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysateSARDH is supported by BioGPS gene expression data to be expressed in HepG2 |
|
