ZNF19 Antibody - N-terminal region (ARP42331_P050)

Data Sheet
 
Product Number ARP42331_P050
Product Page www.avivasysbio.com/znf19-antibody-n-terminal-region-arp42331-p050.html
Name ZNF19 Antibody - N-terminal region (ARP42331_P050)
Protein Size (# AA) 458 amino acids
Molecular Weight 52kDa
NCBI Gene Id 7567
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 19
Alias Symbols KOX12
Peptide Sequence Synthetic peptide located within the following region: TALGYPVPKPALISLLERGDMAWGLEAQDDPPAERTKNVCKDVETNIDSE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kimura,K., (2006) Genome Res. 16 (1), 55-65
Description of Target ZNF19 contains a zinc finger, a nucleic acid-binding domain present in many transcription factors.The protein encoded by this gene contains a zinc finger, a nucleic acid-binding domain present in many transcription factors. This gene is located in a region next to ZNF23, a gene also encoding a zinc finger protein, on chromosome 16.The protein encoded by this gene contains a zinc finger, a nucleic acid-binding domain present in many transcription factors. This gene is located in a region next to ZNF23, a gene also encoding a zinc finger protein, on chromosome 16.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF19 (ARP42331_P050) antibody
Blocking Peptide For anti-ZNF19 (ARP42331_P050) antibody is Catalog # AAP42331 (Previous Catalog # AAPS12412)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF19
Uniprot ID P17023
Protein Name Zinc finger protein 19
Protein Accession # NP_008892
Purification Affinity Purified
Nucleotide Accession # NM_006961
Tested Species Reactivity Human
Gene Symbol ZNF19
Predicted Species Reactivity Human, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Horse: 79%; Human: 100%
Image 1
Human Jurkat
WB Suggested Anti-ZNF19 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com