HBZ Antibody - N-terminal region (ARP42231_T100)

• Product Number: ARP42231_T100
• Name: HBZ Antibody - N-terminal region (ARP42231_T100)
• Protein Size (# AA): 142 amino acids
• Molecular Weight: 16kDa
• Subunit: zeta
• NCBI Gene Id: 3050
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Hemoglobin, zeta
• Alias Symbols: HBAZ, HBZ1, HBZ-T1
• Peptide Sequence: Synthetic peptide located within the following region: ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Hivin,P., J. Cell. Sci. 118 (PT 7), 1355-1362 (2005)
• Description of Target: Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3'.Zeta-globin (HBZ ) is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that involves 4 functional genes and 3 nonfunctional pseudogenes. The order of genes is: 5'-zeta -- pseudozeta -- pseudoalpha2 -- pseudoalpha1 -- alpha2 -- alph1 -- theta1-3'.
• Protein Interactions: NOTCH2NL; KRTAP10-3; KRTAP10-9; KRTAP10-7; KHDRBS2; KRT40; DOCK8; HBD; UPF2; HNRNPD; VCAM1; ITGA4; FN1; APP; SP1; JUND; IKBKG; HBZ; HBB; FGFR3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HBZ (ARP42231_T100) antibody is Catalog # AAP42231 (Previous Catalog # AAPP24654)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HBZ
• Uniprot ID: P02008
• Protein Name: Hemoglobin subunit zeta
• Sample Type Confirmation:

  HBZ is supported by BioGPS gene expression data to be expressed in K562

• Protein Accession #: NP_005323
• Purification: Protein A purified
• Nucleotide Accession #: NM_005332
• Tested Species Reactivity: Human
• Gene Symbol: HBZ
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Goat, Horse, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Goat: 93%; Horse: 86%; Human: 100%; Mouse: 85%; Pig: 93%; Rabbit: 92%; Rat: 93%
• Image 1: Human K562
  
  WB Suggested Anti-HBZ Antibody Titration: 1.25ug/ml
  Positive Control: K562 cell lysateHBZ is supported by BioGPS gene expression data to be expressed in K562
• Image 2: Human Liver
  
  Rabbit Anti-HBZ Antibody
  Catalog Number: ARP42231
  Paraffin Embedded Tissue: Human Liver
  Cellular Data: Hemopoietic
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X