CA8 Antibody - N-terminal region (ARP42166_T100)

• Product Number: ARP42166_T100
• Name: CA8 Antibody - N-terminal region (ARP42166_T100)
• Protein Size (# AA): 290 amino acids
• Molecular Weight: 32kDa
• NCBI Gene Id: 767
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Carbonic anhydrase VIII
• Alias Symbols: CALS, CARP, CA-RP, CAMRQ3, CA-VIII
• Peptide Sequence: Synthetic peptide located within the following region: YEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDC
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Hirota,J., Biochem. J. 372 (PT 2), 435-441 (2003)
• Description of Target: CA8 was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, CA8 lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). CA8 continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family.The protein encoded by this gene was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, the gene product lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). The gene product continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family. The absence of CA8 gene transcription in the cerebellum of the lurcher mutant in mice with a neurologic defect suggests an important role for this acatalytic form.
• Protein Interactions: LNX1; SPDL1; HSD17B14; GGA2; MAGED1; TBX3; CRX; UBC; LRCH4; ITPR1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CA8 (ARP42166_T100) antibody is Catalog # AAP42166 (Previous Catalog # AAPS12003)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CA8
• Uniprot ID: P35219
• Protein Name: Carbonic anhydrase-related protein
• Sample Type Confirmation:

  CA8 is supported by BioGPS gene expression data to be expressed in SKMEL2

• Protein Accession #: NP_004047
• Purification: Protein A purified
• Nucleotide Accession #: NM_004056
• Tested Species Reactivity: Human
• Gene Symbol: CA8
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human SK-MEL-2
  
  WB Suggested Anti-CA8 Antibody Titration: 5.0ug/ml
  Positive Control: SK-MEL-2 cell lysateCA8 is supported by BioGPS gene expression data to be expressed in SKMEL2