| Product Number |
ARP42160_P050 |
| Product Page |
www.avivasysbio.com/btrc-antibody-c-terminal-region-arp42160-p050.html |
| Name |
Btrc Antibody - C-terminal region (ARP42160_P050) |
| Protein Size (# AA) |
605 amino acids |
| Molecular Weight |
69kDa |
| NCBI Gene Id |
12234 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Beta-transducin repeat containing protein |
| Alias Symbols |
Sl, HOS, FWD1, Fbw1, Fbw1a, Slimb, b-TrCP, beta-T, Beta-Tr, beta-TrCP, Beta-Trcp1, SCF b-TRCP, E3RSIkappaB, E3RS-IkappaB |
| Peptide Sequence |
Synthetic peptide located within the following region: LVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAHAEPPRSPSRTY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Btrc is a substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. It recognizes and binds to phosphorylated target proteins. SCF(BTRC) mediates the ubiquitination of CTNNB1 and participates in Wnt signaling. SCF(BTRC) mediates the ubiquitination of NFKBIA, NFKBIB and NFKBIE; the degradation frees the associated NFKB1 to translocate into the nucleus and to activate transcription. Ubiquitination of NFKBIA occurs at 'Lys-21' and 'Lys-22'. SCF(BTRC) mediates the ubiquitination of phosphorylated NFKB1/nuclear factor NF-kappa-B p105 subunit, ATF4, SMAD3, SMAD4, CDC25A, DLG1, FBXO5 and probably NFKB2. SCF(BTRC) mediates the ubiquitination of phosphorylated SNAI1. |
| Protein Interactions |
ZRANB1; Tpx2; Taz; Per2; Cul1; Skp1a; Reg1; Stat1; Nfe2l2; Per1; Htt; Cops2; Ikbkb; Nkx3-2; Cdc25b; Nfkbia; Gli2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Btrc (ARP42160_P050) antibody |
| Blocking Peptide |
For anti-Btrc (ARP42160_P050) antibody is Catalog # AAP42160 (Previous Catalog # AAPS11909) |
| Uniprot ID |
Q3ULA2 |
| Protein Name |
F-box/WD repeat-containing protein 1A |
| Protein Accession # |
NP_001032847 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001037758 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Btrc |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 86% |
| Image 1 | Mouse Pancreas
 | WB Suggested Anti-Btrc Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Pancreas |
|
|
