RBP1 Antibody - middle region (ARP42081_T100)

Data Sheet
 
Product Number ARP42081_T100
Product Page www.avivasysbio.com/rbp1-antibody-middle-region-arp42081-t100.html
Name RBP1 Antibody - middle region (ARP42081_T100)
Protein Size (# AA) 135 amino acids
Molecular Weight 15kDa
NCBI Gene Id 5947
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Retinol binding protein 1, cellular
Alias Symbols CRBP, RBPC, CRBP1, CRBPI, CRABP-I
Peptide Sequence Synthetic peptide located within the following region: IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Belyaeva,O.V., (2005) Biochemistry 44 (18), 7035-7047
Description of Target RBP1 is the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision.RBP1 is the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. The gene harbors four exons encoding 24, 59, 33, and 16 amino acid residues respectively. The second intervening sequence alone occupies 19 kb of the 21 kb of the gene.
Protein Interactions CUL4B; DDB1; SNF8; IKBKG; BRMS1L; ING1; UBC; SIRT1; SIRT2; SAP30; SIN3A; BRMS1; HDAC2; MED26; LRAT; RBBP4; RBBP7; HDAC1; LRP2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RBP1 (ARP42081_T100) antibody
Blocking Peptide For anti-RBP1 (ARP42081_T100) antibody is Catalog # AAP42081 (Previous Catalog # AAPP24560)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RBP1
Uniprot ID P09455
Protein Name Retinol-binding protein 1
Sample Type Confirmation

RBP1 is supported by BioGPS gene expression data to be expressed in HCT116

Protein Accession # NP_002890
Purification Protein A purified
Nucleotide Accession # NM_002899
Tested Species Reactivity Human
Gene Symbol RBP1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Human HCT116
WB Suggested Anti-RBP1 Antibody Titration: 2.5ug/ml
Positive Control: HCT116 cell lysateRBP1 is supported by BioGPS gene expression data to be expressed in HCT116
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com