ALOX15B Antibody - C-terminal region (ARP41895_T100)

• Product Number: ARP41895_T100
• Name: ALOX15B Antibody - C-terminal region (ARP41895_T100)
• Protein Size (# AA): 676 amino acids
• Molecular Weight: 74kDa
• NCBI Gene Id: 247
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Arachidonate 15-lipoxygenase, type B
• Alias Symbols: 15-LOX-2
• Peptide Sequence: Synthetic peptide located within the following region: ATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Subbarayan,V., (2005) Neoplasia 7 (3), 280-293
• Description of Target: ALOX15B is a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively.This gene encodes a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The encoded protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively. This gene is located in a cluster of related genes and a pseudogene that spans approximately 100 kilobases on the short arm of chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been described.
• Protein Interactions: RXRA; PPARG; ERAL1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ALOX15B (ARP41895_T100) antibody is Catalog # AAP41895 (Previous Catalog # AAPP24432)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ALOX15B
• Uniprot ID: O15296
• Protein Name: Arachidonate 15-lipoxygenase B
• Protein Accession #: NP_001132
• Purification: Protein A purified
• Nucleotide Accession #: NM_001141
• Tested Species Reactivity: Human
• Gene Symbol: ALOX15B
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
• Image 1: Human Jurkat
  
  WB Suggested Anti-ALOX15B Antibody Titration: 2.5ug/ml
  Positive Control: Jurkat cell lysate