| Product Number |
ARP41880_P050 |
| Product Page |
www.avivasysbio.com/psg6-antibody-n-terminal-region-arp41880-p050.html |
| Name |
PSG6 Antibody - N-terminal region (ARP41880_P050) |
| Protein Size (# AA) |
424 amino acids |
| Molecular Weight |
47kDa |
| NCBI Gene Id |
5675 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Pregnancy specific beta-1-glycoprotein 6 |
| Alias Symbols |
PSG10, PSGGB, PSBG-6, PSBG-10, PSBG-12 |
| Peptide Sequence |
Synthetic peptide located within the following region: VLLLVHNLPQNLTGYIWYKGQMTDLYHYITSYVVHGQIIYGPAYSGRETV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Teglund,S., (1995) Biochem. Biophys. Res. Commun. 211 (2), 656-664 |
| Description of Target |
PSG6 may have a role in modulation of the innate immune system. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PSG6 (ARP41880_P050) antibody |
| Blocking Peptide |
For anti-PSG6 (ARP41880_P050) antibody is Catalog # AAP41880 (Previous Catalog # AAPP24417) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PSG6 |
| Uniprot ID |
Q15235 |
| Protein Name |
Pregnancy-specific beta-1-glycoprotein 6 |
| Protein Accession # |
NP_001027020 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001031850 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PSG6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 90%; Horse: 79%; Human: 100%; Mouse: 90%; Rat: 90% |
| Image 1 | Human HepG2
 | WB Suggested Anti-PSG6 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
|
|
