GHRHR Antibody - C-terminal region (ARP41859_P050)

• Product Number: ARP41859_P050
• Name: GHRHR Antibody - C-terminal region (ARP41859_P050)
• Protein Size (# AA): 337 amino acids
• Molecular Weight: 37kDa
• NCBI Gene Id: 2692
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Growth hormone releasing hormone receptor
• Alias Symbols: GRFR, GHRFR, IGHD4, IGHD1B
• Peptide Sequence: Synthetic peptide located within the following region: YWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGSLHTQSQYWYCVFV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Gallego,R., (2005) Histol. Histopathol. 20 (3), 697-706
• Description of Target: GHRHR is a receptor for growth hormone-releasing hormone. Binding of this hormone to the receptor leads to synthesis and release of growth hormone. Mutations in its gene have been associated with isolated growth hormone deficiency (IGHD), also known as Dwarfism of Sindh, a disorder characterized by short stature.This gene, expressed in the pituitary, encodes a receptor for growth hormone-releasing hormone. Binding of this hormone to the receptor leads to synthesis and release of growth hormone. Mutations in this gene have been associated with isolated growth hormone deficiency (IGHD), also known as Dwarfism of Sindh, a disorder characterized by short stature. Many alternate transcriptional splice variants encoding different isoforms have been described, but only two have been characterized to date.
• Protein Interactions: GHRH; GHRL; MLNR;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GHRHR (ARP41859_P050) antibody is Catalog # AAP41859 (Previous Catalog # AAPS11008)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GHRHR
• Uniprot ID: Q02643
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that GHRHR is expressed in Jurkat

• Protein Accession #: NP_001009824
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001009824
• Tested Species Reactivity: Human
• Gene Symbol: GHRHR
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 92%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 91%; Rat: 83%; Sheep: 92%
• Image 1: Human Jurkat
  
  WB Suggested Anti-GHRHR Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that GHRHR is expressed in Jurkat