website statistics
Product Datasheet: ARP41859_P050 - GHRHR antibody - C-terminal region (ARP41859_P050) - Aviva Systems Biology
GHRHR antibody - C-terminal region (ARP41859_P050)
Data Sheet
Product Number ARP41859_P050
Product Page
Product Name GHRHR antibody - C-terminal region (ARP41859_P050)
Size 100 ul
Gene Symbol GHRHR
Alias Symbols GHRFR, GHRHRpsv, GRFR, IGHD1B
Protein Size (# AA) 337 amino acids
Molecular Weight 37kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 2692
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Growth hormone releasing hormone receptor
Description This is a rabbit polyclonal antibody against GHRHR. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: YWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGSLHTQSQYWYCVFV
Target Reference Gallego,R., (2005) Histol. Histopathol. 20 (3), 697-706
Description of Target GHRHR is a receptor for growth hormone-releasing hormone. Binding of this hormone to the receptor leads to synthesis and release of growth hormone. Mutations in its gene have been associated with isolated growth hormone deficiency (IGHD), also known as Dwarfism of Sindh, a disorder characterized by short stature.This gene, expressed in the pituitary, encodes a receptor for growth hormone-releasing hormone. Binding of this hormone to the receptor leads to synthesis and release of growth hormone. Mutations in this gene have been associated with isolated growth hormone deficiency (IGHD), also known as Dwarfism of Sindh, a disorder characterized by short stature. Many alternate transcriptional splice variants encoding different isoforms have been described, but only two have been characterized to date.
Protein Interactions GHRH; GHRL; MLNR;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-GHRHR (ARP41859_P050) antibody is Catalog # AAP41859 (Previous Catalog # AAPS11008)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GHRHR
Complete computational species homology data Anti-GHRHR (ARP41859_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GHRHR.
Sample Type Confirmation

There is BioGPS gene expression data showing that GHRHR is expressed in Jurkat

Protein Accession # NP_001009824
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GHRHR.
Nucleotide Accession # NM_001009824
Replacement Item This antibody may replace item sc-54199 from Santa Cruz Biotechnology.
Conjugation Options

ARP41859_P050-FITC Conjugated

ARP41859_P050-HRP Conjugated

ARP41859_P050-Biotin Conjugated

CB Replacement sc-54199; sc-54201; sc-54202; sc-54203
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 91%; Rat: 83%; Sheep: 92%
Image 1
Human Jurkat
WB Suggested Anti-GHRHR Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

There is BioGPS gene expression data showing that GHRHR is expressed in Jurkat


AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |