UROD Antibody - N-terminal region (ARP41724_T100)

• Product Number: ARP41724_T100
• Name: UROD Antibody - N-terminal region (ARP41724_T100)
• Protein Size (# AA): 367 amino acids
• Molecular Weight: 40kDa
• NCBI Gene Id: 7389
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Uroporphyrinogen decarboxylase
• Alias Symbols: PCT, UPD
• Peptide Sequence: Synthetic peptide located within the following region: VPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Harraway,J.R., Ann. Clin. Biochem. 43 (PT 1), 80-82 (2006)
• Description of Target: UROD is the fifth enzyme of the heme biosynthetic pathway. This enzyme is responsible for catalyzing the conversion of uroporphyrinogen to coproporphyrinogen through the removal of four carboxymethyl side chains. Mutations and deficiency in this enzyme are known to cause familial porphyria cutanea tarda and hepatoerythropoetic porphyria.This gene encodes the fifth enzyme of the heme biosynthetic pathway. This enzyme is responsible for catalyzing the conversion of uroporphyrinogen to coproporphyrinogen through the removal of four carboxymethyl side chains. Mutations and deficiency in this enzyme are known to cause familial porphyria cutanea tarda and hepatoerythropoetic porphyria.
• Protein Interactions: FAM84B; UBC; CHRAC1; MTAP; BAG3; NME1; FAF1; HMGXB4; VIM; CHD3; EGFR; UROD;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-UROD (ARP41724_T100) antibody is Catalog # AAP41724 (Previous Catalog # AAPP24367)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UROD
• Uniprot ID: P06132
• Protein Name: Uroporphyrinogen decarboxylase
• Sample Type Confirmation:

  UROD is strongly supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_000365
• Purification: Protein A purified
• Nucleotide Accession #: NM_000374
• Tested Species Reactivity: Human
• Gene Symbol: UROD
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Yeast, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Yeast: 100%; Zebrafish: 83%
• Image 1: Human Kidney
  
  Rabbit Anti-UROD Antibody
  Catalog Number: ARP41724
  Paraffin Embedded Tissue: Human Kidney
  Cellular Data: Epithelial cells of renal tubule
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X
• Image 2: Human HepG2
  
  WB Suggested Anti-UROD Antibody Titration: 2.5ug/ml
  Positive Control: HepG2 cell lysateUROD is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
• Image 3: Human HepG2
  
  Human HepG2