| Product Number |
ARP41686_T100 |
| Product Page |
www.avivasysbio.com/hmgcl-antibody-n-terminal-region-arp41686-t100.html |
| Name |
HMGCL Antibody - N-terminal region (ARP41686_T100) |
| Protein Size (# AA) |
325 amino acids |
| Molecular Weight |
36kDa |
| NCBI Gene Id |
3155 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
3-hydroxymethyl-3-methylglutaryl-CoA lyase |
| Alias Symbols |
HL |
| Peptide Sequence |
Synthetic peptide located within the following region: WVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Fu,Z., (2006) J. Biol. Chem. 281 (11), 7526-7532 |
| Description of Target |
The deficiency of HMGCL is related to an autosomal recessive branched chain organic aciduria. |
| Protein Interactions |
GTF2B; PEX5; ADAMTS10; RNF126; ARL6IP1; DNAJA1; HES1; MS4A7; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HMGCL (ARP41686_T100) antibody |
| Blocking Peptide |
For anti-HMGCL (ARP41686_T100) antibody is Catalog # AAP41686 (Previous Catalog # AAPP24329) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HMGCL |
| Uniprot ID |
P35914 |
| Protein Name |
Hydroxymethylglutaryl-CoA lyase, mitochondrial |
| Protein Accession # |
NP_000182 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_000191 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HMGCL |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%; Zebrafish: 91% |
| Image 1 | Human Liver
 | WB Suggested Anti-HMGCL Antibody Titration: 1.25ug/ml
Positive Control: Human Liver |
|
|
