| Product Number |
ARP41684_P050 |
| Product Page |
www.avivasysbio.com/gamt-antibody-n-terminal-region-arp41684-p050.html |
| Name |
GAMT Antibody - N-terminal region (ARP41684_P050) |
| Protein Size (# AA) |
236 amino acids |
| Molecular Weight |
26kDa |
| NCBI Gene Id |
2593 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Guanidinoacetate N-methyltransferase |
| Alias Symbols |
PIG2, CCDS2, TP53I2, HEL-S-20 |
| Peptide Sequence |
Synthetic peptide located within the following region: MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYM |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Komoto,J., (1999) Acta Crystallogr. D Biol. Crystallogr. 55 (11), 1928-1929 |
| Description of Target |
GAMT is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in its gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumulation of guanidinoacetate in the brain of affected individuals.The protein encoded by this gene is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in this gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumulation of guanidinoacetate in the brain of affected individuals. Two transcript variants encoding different isoforms have been described for this gene. |
| Protein Interactions |
FOS; CSNK2B; UBC; TERF2IP; POT1; TERF1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GAMT (ARP41684_P050) antibody |
| Blocking Peptide |
For anti-GAMT (ARP41684_P050) antibody is Catalog # AAP41684 (Previous Catalog # AAPP24327) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GAMT |
| Uniprot ID |
Q14353 |
| Protein Name |
Guanidinoacetate N-methyltransferase |
| Sample Type Confirmation |
GAMT is supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_000147 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000156 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GAMT |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Guinea Pig: 85%; Human: 100%; Mouse: 92%; Pig: 92%; Rat: 85% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-GAMT Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysateGAMT is supported by BioGPS gene expression data to be expressed in Jurkat |
|
